PrEST Antigen SCN8A

sodium voltage-gated channel alpha subunit 8
Artikelnummer
ATLAPREST95188-100
Verpackungseinheit
100 µl
Hersteller
Atlas Antibodies

Verfügbarkeit: wird geladen...
Preis wird geladen...
Sequence: QEEVSAVVLQRAYRGHLARRGFICKKTTSNKLENGGTHREKKESTPSTASLPSYDSV

GeneName: SCN8A

Ensembl Gene ID: ENSG00000196876

UniProt ID: Q9UQD0

Entrez Gene ID: 6334

Buffer: PBS and 1M Urea, pH 7.4.

Interspecies Mouse/Rat: ENSMUSG00000023033: 96%, ENSRNOG00000005309: 93%

Atlas Antibodies attaches great importance to sustainability. In the production process of their high quality antibodies, Atlas follows the highest and most rigorous ethical animal welfare standards. The products are produced within Europe, which reduces the supply chain length to a minimum and WoolCool (100% natural sheep wool) is used as an insulating material instead of Styrofoam for the transportation of refrigerated goods.

Mehr Informationen
Artikelnummer ATLAPREST95188-100
Hersteller Atlas Antibodies
Hersteller Artikelnummer APrEST95188-100
Verpackungseinheit 100 µl
Mengeneinheit STK
Human Gene ID 6334
Konjugat Unconjugated
Produktinformation (PDF) Download
MSDS (PDF) Download