PrEST Antigen SLC2A13

solute carrier family 2 member 13

Sequence: PESPRWLIQKGQTQKARRILSQMRGNQTIDEEYDSIKNNIEEEEKEVGSAGPVICRMLSYP

GeneName: SLC2A13

Ensembl Gene ID: ENSG00000151229

UniProt ID: Q96QE2

Entrez Gene ID: 114134

Buffer: PBS and 1M Urea, pH 7.4.

Interspecies Mouse/Rat: ENSRNOG00000015741: 90%, ENSMUSG00000036298: 90%

Atlas Antibodies attaches great importance to sustainability. In the production process of their high quality antibodies, Atlas follows the highest and most rigorous ethical animal welfare standards. The products are produced within Europe, which reduces the supply chain length to a minimum and WoolCool (100% natural sheep wool) is used as an insulating material instead of Styrofoam for the transportation of refrigerated goods.

• Artikelnummer: ATLAPREST94829-100
• Hersteller: Atlas Antibodies
• Hersteller Artikelnummer: APrEST94829-100
• Verpackungseinheit: 100 µl
• Mengeneinheit: STK
• Human Gene ID: 114134
• Konjugat: Unconjugated