PrEST Antigen TAF9

TAF9 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 32kDa
Artikelnummer
ATLAPREST91456-100
Verpackungseinheit
100 µl
Hersteller
Atlas Antibodies

Verfügbarkeit: wird geladen...
Preis wird geladen...
Sequence: ASTSAGRITVPRLSVGSVTSRPSTPTLGTPTPQTMSVSTKVGTPMSLTG

GeneName: TAF9

Ensembl Gene ID: ENSG00000273841

UniProt ID: Q16594

Entrez Gene ID: 6880

Buffer: PBS and 1M Urea, pH 7.4.

Interspecies Mouse/Rat: ENSRNOG00000051258: 92%, ENSMUSG00000052293: 92%

Atlas Antibodies attaches great importance to sustainability. In the production process of their high quality antibodies, Atlas follows the highest and most rigorous ethical animal welfare standards. The products are produced within Europe, which reduces the supply chain length to a minimum and WoolCool (100% natural sheep wool) is used as an insulating material instead of Styrofoam for the transportation of refrigerated goods.

Mehr Informationen
Artikelnummer ATLAPREST91456-100
Hersteller Atlas Antibodies
Hersteller Artikelnummer APREST91456-100
Verpackungseinheit 100 µl
Mengeneinheit STK
Human Gene ID 6880
Konjugat Unconjugated
Produktinformation (PDF) Download
MSDS (PDF) Download