PrEST Antigen TEX49

testis expressed 49
Artikelnummer
ATLAPrEST95695-100
Verpackungseinheit
100 µl
Hersteller
Atlas Antibodies

Verfügbarkeit: wird geladen...
Preis wird geladen...
Sequence: KTFPNQVFRIPLTDAQNFSFWWSHDPGVRPEETMPWIRSPRHCLIKSAMTRFMDHSILNDRTFSLY

GeneName: TEX49

Ensembl Gene ID: ENSG00000257987

UniProt ID: A0A1B0GTD5

Entrez Gene ID: 255411

Buffer: PBS and 1M Urea, pH 7.4.

Interspecies Mouse/Rat: ENSMUSG00000022993: 77%, ENSRNOG00000057264: 74%

Atlas Antibodies attaches great importance to sustainability. In the production process of their high quality antibodies, Atlas follows the highest and most rigorous ethical animal welfare standards. The products are produced within Europe, which reduces the supply chain length to a minimum and WoolCool (100% natural sheep wool) is used as an insulating material instead of Styrofoam for the transportation of refrigerated goods.

Mehr Informationen
Artikelnummer ATLAPrEST95695-100
Hersteller Atlas Antibodies
Hersteller Artikelnummer APrEST95695-100
Verpackungseinheit 100 µl
Mengeneinheit STK
Human Gene ID 255411
Konjugat Unconjugated
Produktinformation (PDF) Download
MSDS (PDF) Download