PrEST Antigen TMEM247

transmembrane protein 247

Sequence: SVLVFWMAAEDREMMEARGAGESCPTFPKMVPGDSKSEGKPRAYLEAESQKPDSSYDYLEEMEACEDGGCQGPLKSLSPKSCRAT

GeneName: TMEM247

Ensembl Gene ID: ENSG00000187600

UniProt ID: A6NEH6

Entrez Gene ID: 388946

Buffer: PBS and 1M Urea, pH 7.4.

Interspecies Mouse/Rat: ENSMUSG00000037689: 53%, ENSRNOG00000046926: 52%

Atlas Antibodies attaches great importance to sustainability. In the production process of their high quality antibodies, Atlas follows the highest and most rigorous ethical animal welfare standards. The products are produced within Europe, which reduces the supply chain length to a minimum and WoolCool (100% natural sheep wool) is used as an insulating material instead of Styrofoam for the transportation of refrigerated goods.

• Artikelnummer: ATLAPREST83821
• Hersteller: Atlas Antibodies
• Hersteller Artikelnummer: APREST83821-100
• Verpackungseinheit: 100 µl
• Mengeneinheit: STK
• Human Gene ID: 388946
• Konjugat: Unconjugated