PrEST Antigen TRPM3

transient receptor potential cation channel subfamily M member 3
Artikelnummer
ATLAPREST95128-100
Verpackungseinheit
100 µl
Hersteller
Atlas Antibodies

Verfügbarkeit: wird geladen...
Preis wird geladen...
Sequence: DSEENEAKGRRATIAISSQEGDNSERTLSNNITVPKIERANSYSAEEPSAPYAHTRKSFSISDKLDRQRNTAS

GeneName: TRPM3

Ensembl Gene ID: ENSG00000083067

UniProt ID: Q9HCF6

Entrez Gene ID: 80036

Buffer: PBS and 1M Urea, pH 7.4.

Interspecies Mouse/Rat: ENSMUSG00000052387: 85%, ENSRNOG00000027770: 89%

Atlas Antibodies attaches great importance to sustainability. In the production process of their high quality antibodies, Atlas follows the highest and most rigorous ethical animal welfare standards. The products are produced within Europe, which reduces the supply chain length to a minimum and WoolCool (100% natural sheep wool) is used as an insulating material instead of Styrofoam for the transportation of refrigerated goods.

Mehr Informationen
Artikelnummer ATLAPREST95128-100
Hersteller Atlas Antibodies
Hersteller Artikelnummer APrEST95128-100
Verpackungseinheit 100 µl
Mengeneinheit STK
Human Gene ID 80036
Konjugat Unconjugated
Produktinformation (PDF) Download
MSDS (PDF) Download