PrEST Antigen ZSCAN10

zinc finger and SCAN domain containing 10

Sequence: PSPWPEESSRDQELAAVLECLTFEDVPENKAWPAHPLGFGSRTPDKEEFKQEEPKGAAWPTPILAESQAD

GeneName: ZSCAN10

Ensembl Gene ID: ENSG00000130182

UniProt ID: Q96SZ4

Entrez Gene ID: 84891

Buffer: PBS and 1M Urea, pH 7.4.

Interspecies Mouse/Rat: ENSRNOG00000021782: 61%, ENSMUSG00000023902: 67%

Atlas Antibodies attaches great importance to sustainability. In the production process of their high quality antibodies, Atlas follows the highest and most rigorous ethical animal welfare standards. The products are produced within Europe, which reduces the supply chain length to a minimum and WoolCool (100% natural sheep wool) is used as an insulating material instead of Styrofoam for the transportation of refrigerated goods.

• Artikelnummer: ATLAPREST95425-100
• Hersteller: Atlas Antibodies
• Hersteller Artikelnummer: APrEST95425-100
• Verpackungseinheit: 100 µl
• Mengeneinheit: STK
• Human Gene ID: 84891
• Konjugat: Unconjugated