Anti-BANK1

B-cell scaffold protein with ankyrin repeats 1, Polyclonal, IgG, Rabbit

GeneName: BANK1

Concentration: 0,2

Sequence: IGDTVEVEFTSSNKRIRTRPALWNKKVWCMKALEFPAGSVHVNVYCDGIVKATTKIKYYPTAKAKECLFRMADSGESLCQNSIEELDGVL

InterspeciesReactivity: ENSMUSG00000037922: 68%, ENSRNOG00000032247: 60%

Entrez Gene ID: 55024

Uniprot ID: Q8NDB2

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Long Description: Rabbit Polyclonal BANK1 Antibody against Human B cell scaffold protein with ankyrin repeats 1. Validated for Western Blot

• Artikelnummer: ATLHPA058190-100
• Hersteller: Atlas Antibodies
• Hersteller Artikelnummer: HPA058190-100
• Verpackungseinheit: 100UL
• Mengeneinheit: STK
• Reaktivität: Human
• Klonalität: Polyclonal
• Methode: Western Blotting
• Isotyp: IgG
• Human Gene ID: 55024
• Wirt: Rabbit
• Konjugat: Unconjugated