Anti-SPSB4

splA/ryanodine receptor domain and SOCS box containing 4, Polyclonal, IgG, Rabbit

GeneName: SPSB4

Concentration: 0,05

Sequence: YPVVSAVWGHCEVTMRYINGLDPEPLPLMDLCRRSIRSALGRQRLQDI

InterspeciesReactivity: ENSMUSG00000046997: 98%, ENSRNOG00000012862: 98%

Entrez Gene ID: 92369

Uniprot ID: Q96A44

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Long Description: Rabbit Polyclonal SPSB4 Antibody against Human splA/ryanodine receptor domain and SOCS box containing 4. Validated for Western Blot

• Artikelnummer: ATLHPA069666-100
• Hersteller: Atlas Antibodies
• Hersteller Artikelnummer: HPA069666-100
• Verpackungseinheit: 100UL
• Mengeneinheit: STK
• Reaktivität: Human
• Klonalität: Polyclonal
• Methode: Western Blotting
• Isotyp: IgG
• Human Gene ID: 92369
• Wirt: Rabbit
• Konjugat: Unconjugated