Anti-VPS39

VPS39 subunit of HOPS complex, Polyclonal, IgG, Rabbit

GeneName: VPS39

Concentration: 0,1

Sequence: AWCENSICVGFKRDYYLIRVDGKGSIKELFPTGKQLEPLVAPLADGKVAVGQDDLTVVLNEEGICTQKCALNWTDIPVAMEHQPPYIIAVLPRYVEIRTFEPRLLVQSIE

InterspeciesReactivity: ENSMUSG00000027291: 98%, ENSRNOG00000008316: 97%

Entrez Gene ID: 23339

Uniprot ID: Q96JC1

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Long Description: Rabbit Polyclonal VPS39 Antibody against Human VPS39 subunit of HOPS complex. Validated for Western Blot

• Artikelnummer: ATLHPA048192-25
• Hersteller: Atlas Antibodies
• Hersteller Artikelnummer: HPA048192-25
• Verpackungseinheit: 25UL
• Mengeneinheit: STK
• Reaktivität: Human
• Klonalität: Polyclonal
• Methode: Western Blotting
• Isotyp: IgG
• Human Gene ID: 23339
• Wirt: Rabbit
• Konjugat: Unconjugated