Anti-WSB1

WD repeat and SOCS box containing 1, Polyclonal, IgG, Rabbit

GeneName: WSB1

Concentration: 0,05

Sequence: SYDTRVYIWDPHNGDILMEFGHLFPPPTPIFAGGANDRWVRSVSFSHDGLHVASLADDKMVRFWRIDEDYPVQVA

InterspeciesReactivity: ENSMUSG00000017677: 93%, ENSRNOG00000012929: 89%

Entrez Gene ID: 26118

Uniprot ID: Q9Y6I7

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Long Description: Rabbit Polyclonal WSB1 Antibody against Human WD repeat and SOCS box containing 1. Validated for Western Blot

• Artikelnummer: ATLHPA067752-100
• Hersteller: Atlas Antibodies
• Hersteller Artikelnummer: HPA067752-100
• Verpackungseinheit: 100UL
• Mengeneinheit: STK
• Reaktivität: Human
• Klonalität: Polyclonal
• Methode: Western Blotting
• Isotyp: IgG
• Human Gene ID: 26118
• Wirt: Rabbit
• Konjugat: Unconjugated