Anti-WWC1

WW and C2 domain containing 1, Polyclonal, IgG, Rabbit

GeneName: WWC1

Concentration: 0,05

Sequence: SGVYEASVQRLGASEAAAFDSDESEAVGATRIQIALKYDEKNKQFAILIIQLSNLSAL

InterspeciesReactivity: ENSMUSG00000018849: 91%, ENSRNOG00000008065: 88%

Entrez Gene ID: 23286

Uniprot ID: Q8IX03

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Long Description: Rabbit Polyclonal WWC1 Antibody against Human WW and C2 domain containing 1. Validated for Western Blot

• Artikelnummer: ATLHPA066092-100
• Hersteller: Atlas Antibodies
• Hersteller Artikelnummer: HPA066092-100
• Verpackungseinheit: 100UL
• Mengeneinheit: STK
• Reaktivität: Human
• Klonalität: Polyclonal
• Methode: Western Blotting
• Isotyp: IgG
• Human Gene ID: 23286
• Wirt: Rabbit
• Konjugat: Unconjugated