Brain Natriuretic Peptide-32 (rat) (acetate)

Shelf life (days): 1460.0

Formulation: A solid

Amino Acids: NSKMAHSSSCFGQKIDRIGAVSRLGCDGLRLF-OH

Purity: ≥98%

Formula Markup: C146H239N47O44S3 / XC2H4O2

Formula Weight: 3452.9

Notes: A natriuretic peptide; binds to natriuretic peptide receptors on rat vascular smooth muscle cells (IC50 = 7.3 nM) and induces cGMP accumulation in the same cells (EC50 = 170 nM); induces relaxation of norepinephrine-precontracted isolated rat aortic strips (EC50 = 6.7 nM); increases urine and urinary electrolyte excretion and induces hypotension in rats at 3 µg/kg

• Artikelnummer: CAY39724-500
• Hersteller: Cayman Chemical
• Hersteller Artikelnummer: 39724-500
• Verpackungseinheit: 500 µg
• Mengeneinheit: STK