PrEST Antigen CLECL1

C-type lectin like 1
Artikelnummer
ATLAPREST94879-100
Verpackungseinheit
100 µl
Hersteller
Atlas Antibodies

Verfügbarkeit: wird geladen...
Preis wird geladen...
Sequence: ADIKTVRTSPLELAFPLQRSVSFNFSTVHKSCPAKDWKVHKGKCYWIAETKKSWNKSQNDCAINNSYLMVIQDITAMVRF

GeneName: CLECL1

EnsemblGeneId: ENSG00000184293

UniprotId: Q8IZS7

EntrezGeneId: 160365

Buffer: PBS and 1M Urea, pH 7.4.

Description: PrEST Antigen CLECL1 antigen APrEST94879 for C-type lectin like 1

Interspecies Mouse/Rat: ENSMUSG00000030147: 26%, ENSRNOG00000018715: 26%

"

Atlas Antibodies attaches great importance to sustainability. In the production process of their high quality antibodies, Atlas follows the highest and most rigorous ethical animal welfare standards. The products are produced within Europe, which reduces the supply chain length to a minimum and WoolCool (100% natural sheep wool) is used as an insulating material instead of Styrofoam for the transportation of refrigerated goods.

Mehr Informationen
Artikelnummer ATLAPREST94879-100
Hersteller Atlas Antibodies
Hersteller Artikelnummer APrEST94879-100
Verpackungseinheit 100 µl
Mengeneinheit STK
Human Gene ID 160365
Produktinformation (PDF) Download
MSDS (PDF) Download