PrEST Antigen KLRF1

killer cell lectin like receptor F1

Sequence: GSCSNATQYEDTGDLKVNNGTRRNISNKDLCASRSADQTVLCQSEWLKYQGKCYWFSNEMKSWSDSYVYCLER

GeneName: KLRF1

EnsemblGeneId: ENSG00000150045

UniprotId: Q9NZS2

EntrezGeneId: 51348

Buffer: PBS and 1M Urea, pH 7.4.

Description: PrEST Antigen KLRF1 antigen APrEST94729 for killer cell lectin like receptor F1

Interspecies Mouse/Rat: ENSMUSG00000071158: 32%, ENSRNOG00000014975: 27%

"

Atlas Antibodies attaches great importance to sustainability. In the production process of their high quality antibodies, Atlas follows the highest and most rigorous ethical animal welfare standards. The products are produced within Europe, which reduces the supply chain length to a minimum and WoolCool (100% natural sheep wool) is used as an insulating material instead of Styrofoam for the transportation of refrigerated goods.

• Artikelnummer: ATLAPREST94729-100
• Hersteller: Atlas Antibodies
• Hersteller Artikelnummer: APrEST94729-100
• Verpackungseinheit: 100 µl
• Mengeneinheit: STK
• Human Gene ID: 51348