PrEST Antigen LGALS4

lectin, galactoside-binding, soluble, 4
Artikelnummer
ATLAPREST88915
Verpackungseinheit
100 µl
Hersteller
Atlas Antibodies

Verfügbarkeit: wird geladen...
Preis wird geladen...
Sequence: PGPGHCHQQLNSLPTMEGPPTFNPPVPYFGRLQGGLTARRTIIIKGYVPPTGKSFAINFKVGSS

GeneName: LGALS4

Ensembl Gene ID: ENSG00000171747

UniProt ID: P56470

Entrez Gene ID: 3960

Buffer: PBS and 1M Urea, pH 7.4.

Interspecies Mouse/Rat: ENSRNOG00000020338: 72%, ENSMUSG00000053964: 69%

Atlas Antibodies attaches great importance to sustainability. In the production process of their high quality antibodies, Atlas follows the highest and most rigorous ethical animal welfare standards. The products are produced within Europe, which reduces the supply chain length to a minimum and WoolCool (100% natural sheep wool) is used as an insulating material instead of Styrofoam for the transportation of refrigerated goods.

Mehr Informationen
Artikelnummer ATLAPREST88915
Hersteller Atlas Antibodies
Hersteller Artikelnummer APREST88915-100
Verpackungseinheit 100 µl
Mengeneinheit STK
Methode Blocking, Control
Human Gene ID 3960
Wirt Escherichia Coli
Konjugat Unconjugated
Produktinformation (PDF) Download
MSDS (PDF) Download