PrEST Antigen MASP2

mannan-binding lectin serine peptidase 2
Artikelnummer
ATLAPREST86768
Verpackungseinheit
100 µl
Hersteller
Atlas Antibodies

Verfügbarkeit: wird geladen...
Preis wird geladen...
Sequence: PVCEPVCGLSARTTGGRIYGGQKAKPGDFPWQVLILGGTTAAGALLYDNWVLTAAHAVYEQKHDASALDIRMGTLKRLSPHYTQAWSEAVFIHEGYTHDAGFDNDIALIKLNNKVVINSNITPICLPRKEAESFMRTDDIGTASGWGL

GeneName: MASP2

Ensembl Gene ID: ENSG00000009724

UniProt ID: O00187

Entrez Gene ID: 10747

Buffer: PBS and 1M Urea, pH 7.4.

Concentration: 6.8

Interspecies Mouse/Rat: ENSRNOG00000011258: 78%, ENSMUSG00000028979: 78%

Atlas Antibodies attaches great importance to sustainability. In the production process of their high quality antibodies, Atlas follows the highest and most rigorous ethical animal welfare standards. The products are produced within Europe, which reduces the supply chain length to a minimum and WoolCool (100% natural sheep wool) is used as an insulating material instead of Styrofoam for the transportation of refrigerated goods.

Mehr Informationen
Artikelnummer ATLAPREST86768
Hersteller Atlas Antibodies
Hersteller Artikelnummer APREST86768-100
Verpackungseinheit 100 µl
Mengeneinheit STK
Methode Blocking, Control
Human Gene ID 10747
Wirt Escherichia Coli
Konjugat Unconjugated
Produktinformation (PDF) Download
MSDS (PDF) Download