Recombinant Human Galectin-7 (LGALS7)

Recombinant Human Galectin-7 (LGALS7)
Artikelnummer
CSB-EP012892HU-20
Verpackungseinheit
20 µg
Hersteller
Cusabio

Verfügbarkeit: wird geladen...
Preis wird geladen...
Research Areas: Neuroscience

Uniprot: P47929

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Form: Liquid or Lyophilized powder

Tag Info: N-terminal 6xHis-tagged

Purity: Greater than 90% as determined by SDS-PAGE.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Molecular Weight: 18.9 kDa

Gene Names: LGALS7

Organism: Homo sapiens (Human)

Source: E.coli

Expression Region: 2-136aa

Protein Length: Full Length of Mature Protein

Target Protein Sequence: SNVPHKSSLPEGIRPGTVLRIRGLVPPNASRFHVNLLCGEEQGSDAALHFNPRLDTSEVVFNSKEQGSWGREERGPGVPFQRGQPFEVLIIASDDGFKAVVGDAQYHHFRHRLPLARVRLVEVGGDVQLDSVRIF

Endotoxin: Not test.

Relevance: Could be involved in cell-cell and/or cell-matrix interactions necessary for normal growth control. Pro-apoptotic protein that functions intracellularly upstream of JNK activation and cytochrome c release.

Reference: Cloning, expression, and chromosome mapping of human galectin-7.Madsen P., Rasmussen H.H., Flint T., Gromov P., Kruse T.A., Honore B., Vorum H., Celis J.E.J. Biol. Chem. 270:5823-5829(1995)

Function: Could be involved in cell-cell and/or cell-matrix interactions necessary for normal growth control. Pro-apoptotic protein that functions intracellularly upstream of JNK activation and cytochrome c release.
Mehr Informationen
Artikelnummer CSB-EP012892HU-20
Hersteller Cusabio
Hersteller Artikelnummer CSB-EP012892HU-20
Verpackungseinheit 20 µg
Mengeneinheit STK
Produktinformation (PDF) Download
MSDS (PDF) Download