Research Areas: Cancer
Uniprot: P20138
Buffer: Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Form: Lyophilized powder
Tag Info: C-terminal hFc-Myc-tagged
Purity: Greater than 95% as determined by SDS-PAGE.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Molecular Weight: 56.9 kDa
Gene Names: CD33
Organism: Homo sapiens (Human)
Source: Mammalian cell
Expression Region: 18-259aa
Protein Length: Partial
Target Protein Sequence: DPNFWLQVQESVTVQEGLCVLVPCTFFHPIPYYDKNSPVHGYWFREGAIISRDSPVATNKLDQEVQEETQGRFRLLGDPSRNNCSLSIVDARRRDNGSYFFRMERGSTKYSYKSPQLSVHVTDLTHRPKILIPGTLEPGHSKNLTCSVSWACEQGTPPIFSWLSAAPTSLGPRTTHSSVLIITPRPQDHGTNLTCQVKFAGAGVTTERTIQLNVTYVPQNPTTGIFPGDGSGKQETRAGVVH
Endotoxin: Less than 1.0 EU/ug as determined by LAL method.
Biological_Activity: Measured by its binding ability in a functional ELISA. Immobilized CD33 at 2 μg/ml can bind Anti-CD33 rabbit monoclonal antibody, the EC50 of human CD33 protein is 4.289- 5.312 ng/ml.
Relevance: Sialic-acid-binding immunoglobulin-like lectin that plays a role in mediating cell-cell interactions and in maintaining immune cells in a resting state . Preferentially recognizes and binds alpha-2,3- and more avidly alpha-2,6-linked sialic acid-bearing glycans . Upon engagement of ligands such as C1q or syalylated glycoproteins, two immunoreceptor tyrosine-based inhibitory motifs located in CD33 cytoplasmic tail are phosphorylated by Src-like kinases such as LCK . These phosphorylations provide docking sites for the recruitment and activation of protein-tyrosine phosphatases PTPN6/SHP-1 and PTPN11/SHP-2 . In turn, these phosphatases regulate downstream pathways through dephosphorylation of signaling molecules . One of the repressive effect of CD33 on monocyte activation requires phosphoinositide 3-kinase/PI3K .