Recombinant Rana japonica Sialic acid-binding lectin

Recombinant Rana japonica Sialic acid-binding lectin
Artikelnummer
CSB-EP321644RJL-20
Verpackungseinheit
20 µg
Hersteller
Cusabio

Verfügbarkeit: wird geladen...
Preis wird geladen...
Research Areas: Others

Uniprot: P18839

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Form: Liquid or Lyophilized powder

Tag Info: N-terminal 6xHis-tagged

Purity: Greater than 90% as determined by SDS-PAGE.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Molecular Weight: 16.3 kDa

Gene Names: N/A

Organism: Rana japonica (Japanese reddish frog)

Source: E.coli

Expression Region: 1-111aa

Protein Length: Full Length

Target Protein Sequence: QNWAKFQEKHIPNTSNINCNTIMDKSIYIVGGQCKERNTFIISSATTVKAICSGASTNRNVLSTTRFQLNTCIRSATAPRPCPYNSRTETNVICVKCENRLPVHFAGIGRC

Endotoxin: Not test.

Relevance: The S-lectins in frog eggs may be involved in the fertilization and development of the frog bryo. This lectin preferentially agglutinate a large variety of tumor cells, but it does not agglutinate non-transformed cells and erythrocytes.

Reference: Amino acid sequence of a lectin from Japanese frog (Rana japonica) eggs.Kamiya Y., Oyama F., Oyama R., Sakakibara F., Nitta K., Kawauchi H., Takayanagi Y., Titani K.J. Biochem. 108:139-143(1990)

Function: The S-lectins in frog eggs may be involved in the fertilization and development of the frog embryo. This lectin preferentially agglutinate a large variety of tumor cells, but it does not agglutinate non-transformed cells and erythrocytes.
Mehr Informationen
Artikelnummer CSB-EP321644RJL-20
Hersteller Cusabio
Hersteller Artikelnummer CSB-EP321644RJL-20
Verpackungseinheit 20 µg
Mengeneinheit STK
Produktinformation (PDF) Download
MSDS (PDF) Download