Research Areas: Others
Uniprot: Q9K6B9
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Form: Liquid or Lyophilized powder
Tag Info: C-terminal 6xHis-tagged
Purity: Greater than 95% as determined by SDS-PAGE.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Molecular Weight: 39.1 kDa
Gene Names: speB
Organism: Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) (Bacillus halodurans)
Source: E.coli
Expression Region: 1-289aa
Protein Length: Full Length
Target Protein Sequence: MRFDEAYSGKVFIMSRSNYEKSKAVIFGMPMDWTVSFRPSSRFGPNRIREASLGLEEYSPYMDKHLEEVAYFDAGDMLLPFGNPQRSLEMIESYVDKLLADQKMPIGLGGEHLVSWPIFKAMHKIYPDMAIIHIDAHADLREEYEGEPLSHSTPIRKACSLIGPENVYSFGIRSGMREEFQYAKDSGMYMAKFEVATPLKEVLPKLAGRNVYVTIDIDVLDPAFAPGTGTAEAGGISSKELLEAIVAIAHSDVNVIGADLVEVAPAYDPSEKTPIAASKFVREMLLGWV
Endotoxin: Not test.
Relevance: Catalyzes the formation of putrescine from agmatine.