Recombinant Human Serine/threonine-protein phosphatase PGAM5,mitochondrial (PGAM5), partial

Recombinant Human Serine/threonine-protein phosphatase PGAM5,mitochondrial (PGAM5), partial
Artikelnummer
CSB-EP839338HU-20
Verpackungseinheit
20 µg
Hersteller
Cusabio

Verfügbarkeit: wird geladen...
Preis wird geladen...
Research Areas: Cancer

Uniprot: Q96HS1

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Form: Liquid or Lyophilized powder

Tag Info: N-terminal GST-tagged

Purity: Greater than 85% as determined by SDS-PAGE.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Molecular Weight: 56.8 kDa

Gene Names: PGAM5

Organism: Homo sapiens (Human)

Source: E.coli

Expression Region: 30-289aa

Protein Length: Partial

Target Protein Sequence: KPRAGGDAEPRPAEPPAWAGGARPGPGVWDPNWDRREPLSLINVRKRNVESGEEELASKLDHYKAKATRHIFLIRHSQYHVDGSLEKDRTLTPLGREQAELTGLRLASLGLKFNKIVHSSMTRAIETTDIISRHLPGVCKVSTDLLREGAPIEPDPPVSHWKPEAVQYYEDGARIEAAFRNYIHRADARQEEDSYEIFICHANVIRYIVCRALQFPPEGWLRLSLNNGSITHLVIRPNGRVALRTLGDTGFMPPDKITRS

Endotoxin: Not test.

Relevance: Displays phosphatase activity for serine/threonine residues, and, dephosphorylates and activates MAP3K5 kinase. Has apparently no phosphoglycerate mutase activity. May be regulator of mitochondrial dynamics. Substrate for a KEAP1-dependent ubiquitin ligase complex. Contributes to the repression of NFE2L2-dependent gene expression. Acts as a central mediator for programmed necrosis induced by TNF, by reactive oxygen species and by calcium ionophore.
Mehr Informationen
Artikelnummer CSB-EP839338HU-20
Hersteller Cusabio
Hersteller Artikelnummer CSB-EP839338HU-20
Verpackungseinheit 20 µg
Mengeneinheit STK
Produktinformation (PDF)
×
MSDS (PDF) Download