Recombinant Mouse CD209 antigen-like protein B (Cd209b), partial

Recombinant Mouse CD209 antigen-like protein B (Cd209b), partial
Artikelnummer
CSB-EP817227MO-20
Verpackungseinheit
20 µg
Hersteller
Cusabio

Verfügbarkeit: wird geladen...
Preis wird geladen...
Research Areas: Immunology

Uniprot: Q8CJ91

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Form: Liquid or Lyophilized powder

Tag Info: N-terminal 10xHis-tagged

Purity: Greater than 95% as determined by SDS-PAGE.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Molecular Weight: 35.3 kDa

Gene Names: Cd209b

Organism: Mus musculus (Mouse)

Source: E.coli

Expression Region: 74-325aa

Protein Length: Partial

Target Protein Sequence: QVSKTPNTERQKEQEKILQELTQLTDELTSRIPISQGKNESMQAKITEQLMQLKTELLSRIPIFQGQNESIQEKISEQLMQLKAELLSKISSFPVKDDSKQEKIYQQLVQMKTELFRLCRLCPWDWTFLLGNCYFFSKSQRNWNDAVTACKEVKAQLVIINSDEEQTFLQQTSKAKGPTWMGLSDLKKEATWLWVDGSTLSSRFQKYWNRGEPNNIGEEDCVEFAGDGWNDSKCELKKFWICKKSATPCTEG

Endotoxin: Not test.

Relevance: Probable pathogen-recognition receptor. May mediate the endocytosis of pathogens which are subsequently degraded in lysosomal compartments. May recognize in a calcium-dependent manner high mannose N-linked oligosaccharides in a variety of pathogen antigens. Is a receptor for ICAM3, probably by binding to mannose-like carbohydrates.
Mehr Informationen
Artikelnummer CSB-EP817227MO-20
Hersteller Cusabio
Hersteller Artikelnummer CSB-EP817227MO-20
Verpackungseinheit 20 µg
Mengeneinheit STK
Produktinformation (PDF)
×
MSDS (PDF) Download