FOXL1 Antibody - middle region : Biotin

FOXL1 Antibody - middle region : Biotin
Artikelnummer
AVIARP57981_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: The exact function of FOXL1 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human FOXL1

Key Reference: Hassel,S., (2004) Proteomics 4 (5), 1346-1358

Molecular Weight: 36kDa

Peptide Sequence: Synthetic peptide located within the following region: EDAGDAAQGAAAVAVGQAARTGDGPGSPLRPASRSSPKSSDKSKSFSIDS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Forkhead box protein L1

Protein Size: 345

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57981_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57981_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Pig (Porcine), Dog (Canine), Cow (Bovine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 2300
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×