FOXN3 Antibody - middle region : Biotin

FOXN3 Antibody - middle region : Biotin
Artikelnummer
AVIARP57855_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: FOXN3 gene is a member of the forkhead/winged helix transcription factor family. Checkpoints are eukaryotic DNA damage-inducible cell cycle arrests at G1 and G2. Checkpoint suppressor 1 suppresses multiple yeast checkpoint mutations including mec1, rad9, rad53 and dun1 by activating a MEC1-independent checkpoint pathway. Alternative splicing is observed at the locus, resulting in distinct isoforms.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human FOXN3

Molecular Weight: 51kDa

Peptide Sequence: Synthetic peptide located within the following region: EGSFRSHESPSDTEEDDRKHSQKEPKDSLGDSGYASQHKKRQHFAKARKV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Forkhead box protein N3

Protein Size: 468

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57855_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57855_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 1112
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×