FOXN3 Antibody - middle region : HRP

FOXN3 Antibody - middle region : HRP
Artikelnummer
AVIARP57855_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: FOXN3 gene is a member of the forkhead/winged helix transcription factor family. Checkpoints are eukaryotic DNA damage-inducible cell cycle arrests at G1 and G2. Checkpoint suppressor 1 suppresses multiple yeast checkpoint mutations including mec1, rad9, rad53 and dun1 by activating a MEC1-independent checkpoint pathway. Alternative splicing is observed at the locus, resulting in distinct isoforms.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human FOXN3

Molecular Weight: 51kDa

Peptide Sequence: Synthetic peptide located within the following region: EGSFRSHESPSDTEEDDRKHSQKEPKDSLGDSGYASQHKKRQHFAKARKV

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Forkhead box protein N3

Protein Size: 468

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57855_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57855_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 1112
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×