Frg1 Antibody - middle region : FITC

Frg1 Antibody - middle region : FITC
Artikelnummer
AVIARP54731_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Frg1 may have a role in processing of pre-rRNA or in the assembly of rRNA into ribosomal subunits and also may be involved in pre-mRNA splicing

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse

Molecular Weight: 28kDa

Peptide Sequence: Synthetic peptide located within the following region: GINSDGLVVGRSDAIGPREQWEPVFQDGKMALLASNSCFIRCNEAGDIEA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein FRG1

Protein Size: 258

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54731_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54731_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Goat (Caprine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 14300
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×