FRZB Antibody - N-terminal region : FITC

FRZB Antibody - N-terminal region : FITC
Artikelnummer
AVIARP54570_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The protein encoded by this gene is a secreted protein that is involved in the regulation of bone development. Defects in this gene are a cause of female-specific osteoarthritis (OA) susceptibility.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human FRZB

Molecular Weight: 36kDa

Peptide Sequence: Synthetic peptide located within the following region: HSTQANAILAIEQFEGLLGTHCSPDLLFFLCAMYAPICTIDFQHEPIKPC

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Secreted frizzled-related protein 3

Protein Size: 325

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54570_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54570_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 2487
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×