FSCN3 Antibody - C-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: FSCN3 acts as an actin bundling protein.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human FSCN3

Molecular Weight: 55kDa

Peptide Sequence: Synthetic peptide located within the following region: YDGEVRAASERLNRMSLFQFECDSESPTVQLRSANGYYLSQRRHRAVMAD

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Fascin-3

Protein Size: 498

Purification: Affinity Purified

• Artikelnummer: AVIARP53740_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP53740_P050-FITC
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Cow (Bovine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 29999
• Wirt: Rabbit
• Konjugat: Conjugated, FITC