FSCN3 Antibody - middle region : Biotin

FSCN3 Antibody - middle region : Biotin
Artikelnummer
AVIARP53741_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: FSCN3 acts as an actin bundling protein.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human FSCN3

Molecular Weight: 55kDa

Peptide Sequence: Synthetic peptide located within the following region: WGKFALNFCIELQGSNLLTVLAPNGFYMRADQSGTLLADSEDITRECIWE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Fascin-3

Protein Size: 498

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP53741_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP53741_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 29999
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×