FSTL5 Antibody - middle region : HRP

FSTL5 Antibody - middle region : HRP
Artikelnummer
AVIARP57353_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human FSTL5

Molecular Weight: 92kDa

Peptide Sequence: Synthetic peptide located within the following region: EAFDIYTNLHISDLAFQPSFTEAHQYNIYGSSSTQTDVLFVELSSGKVKM

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Follistatin-related protein 5

Protein Size: 837

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57353_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57353_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Zebrafish
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 56884
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×