FTSJD2 Antibody - C-terminal region : Biotin

FTSJD2 Antibody - C-terminal region : Biotin
Artikelnummer
AVIARP55152_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: FTSJD2 is a S-adenosyl-L-methionine-dependent methyltransferase that mediates mRNA cap1 2'-O-ribose methylation to the 5'-cap structure of mRNAs. It methylates the ribose of the first nucleotide of a m7GpppG-capped mRNA to produce m7GpppNmp (cap1). Cap1 modification is linked to higher levels of translation. It may be involved in the interferon response pathway.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human FTSJD2

Molecular Weight: 95kDa

Peptide Sequence: Synthetic peptide located within the following region: YRLEEMEKIFVRLEMKIIKGSSGTPKLSYTGRDDRHFVPMGLYIVRTVNE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase 1

Protein Size: 835

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55152_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55152_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 23070
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×