GABARAPL1 Antibody - middle region : FITC

GABARAPL1 Antibody - middle region : FITC
Artikelnummer
AVIARP55399_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: GABARAPL1 increases cell-surface expression of kappa-type opioid receptor through facilitating anterograde intracellular trafficking of the receptor.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human GABARAPL1

Key Reference: Tanida,I., (2006) FEBS J. 273 (11), 2553-2562

Molecular Weight: 14kDa

Peptide Sequence: Synthetic peptide located within the following region: KAPKARVPDLDKRKYLVPSDLTVGQFYFLIRKRIHLRPEDALFFFVNNTI

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Gamma-aminobutyric acid receptor-associated protein-like 1

Protein Size: 117

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55399_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55399_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting, Immunohistochemistry
Human Gene ID 23710
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×