GABARAPL1 Antibody - N-terminal region : HRP

GABARAPL1 Antibody - N-terminal region : HRP
Artikelnummer
AVIARP55398_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: GABARAPL1 increases cell-surface expression of kappa-type opioid receptor through facilitating anterograde intracellular trafficking of the receptor.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human GABARAPL1

Key Reference: Tanida,I., (2006) FEBS J. 273 (11), 2553-2562

Molecular Weight: 14kDa

Peptide Sequence: Synthetic peptide located within the following region: MKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLDKRKYL

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Gamma-aminobutyric acid receptor-associated protein-like 1

Protein Size: 117

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55398_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55398_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting, Immunohistochemistry
Human Gene ID 23710
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×