GBA3 Antibody - N-terminal region : Biotin

GBA3 Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP57505_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: GBA3, or cytosolic beta-glucosidase (EC 3.2.1.21), is a predominantly liver enzyme that efficiently hydrolyzes beta-D-glucoside and beta-D-galactoside, but not any known physiologic beta-glycoside, suggesting that it may be involved in detoxification of plant glycosides (de Graaf et al., 2001 [PubMed 11389701]). GBA3 also has significant neutral glycosylceramidase activity (EC 3.2.1.62), suggesting that it may be involved in a nonlysosomal catabolic pathway of glucosylceramide metabolism (Hayashi et al., 2007 [PubMed 17595169]).

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human GBA3

Molecular Weight: 54kDa

Peptide Sequence: Synthetic peptide located within the following region: LTHYRFSLSWSRLLPDGTTGFINQKGIDYYNKIIDDLLKNGVTPIVTLYH

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Cytosolic beta-glucosidase

Protein Size: 469

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57505_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57505_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 57733
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×