GBP2 Antibody - N-terminal region : FITC

GBP2 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP54715_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: GBPs are characterized by their ability to specifically bind guanine nucleotides (GMP, GDP, and GTP). GBP2 is a GTPase that converts GTP to GDP and GMP.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human GBP2

Molecular Weight: 67kDa

Peptide Sequence: Synthetic peptide located within the following region: HYVTELTDRIKANSSPGNNSVDDSADFVSFFPAFVWTLRDFTLELEVDGE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Interferon-induced guanylate-binding protein 2

Protein Size: 591

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54715_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54715_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Rat (Rattus), Rabbit, Guinea Pig, Cow (Bovine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 2634
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×