GBP2 Antibody - N-terminal region : HRP

GBP2 Antibody - N-terminal region : HRP
Artikelnummer
AVIARP54714_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: GBPs are characterized by their ability to specifically bind guanine nucleotides (GMP, GDP, and GTP). GBP2 is a GTPase that converts GTP to GDP and GMP. Interferons are cytokines that have antiviral effects and inhibit tumor cell proliferation. They induce a large number of genes in their target cells, including those coding for the guanylate-binding proteins (GBPs). GBPs are characterized by their ability to specifically bind guanine nucleotides (GMP, GDP, and GTP). The protein encoded by this gene is a GTPase that converts GTP to GDP and GMP.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human GBP2

Key Reference: Lukasiewicz,R., (2007) J. Biol. Chem. 282 (32), 23036-23043

Molecular Weight: 67kDa

Peptide Sequence: Synthetic peptide located within the following region: HTKGIWMWCVPHPKKPEHTLVLLDTEGLGDIEKGDNENDSWIFALAILLS

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Interferon-induced guanylate-binding protein 2

Protein Size: 591

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54714_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54714_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 2634
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×