GCET2 Antibody - middle region : FITC

GCET2 Antibody - middle region : FITC
Artikelnummer
AVIARP55553_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: GCET2 is a protein which may function in signal transduction pathways and whose expression is elevated in germinal cell lymphomas. It contains a putative PDZ-interacting domain, an immunoreceptor tyrosine-based activation motif (ITAM), and two putative SH2 binding sites. In B cells, its expression is specifically induced by interleukin-4.This gene encodes a protein which may function in signal transduction pathways and whose expression is elevated in germinal cell lymphomas. It contains a putative PDZ-interacting domain, an immunoreceptor tyrosine-based activation motif (ITAM), and two putative SH2 binding sites. In B cells, its expression is specifically induced by interleukin-4. Alternative splicing results in multiple transcript variants encoding different isoforms.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human GCET2

Key Reference: Lu,X., (2007) Blood 110 (13), 4268-4277

Molecular Weight: 21kDa

Peptide Sequence: Synthetic peptide located within the following region: YSLLHMPSTDPRHARSPEDEYELLMPHRISSHFLQQPRPLMAPSETQFSH

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Germinal center-associated signaling and motility protein

Protein Size: 178

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55553_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55553_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 257144
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×