GEMIN4 Antibody - N-terminal region : Biotin

GEMIN4 Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP56757_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: The product of this gene is part of a large complex localized to the cytoplasm, nucleoli, and to discrete nuclear bodies called Gemini bodies (gems). The complex functions in spliceosomal snRNP assembly in the cytoplasm, and regenerates spliceosomes requi

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human GEMIN4

Key Reference: Shpargel,K.B. (2005) Proc. Natl. Acad. Sci. U.S.A. 102 (48), 17372-17377

Molecular Weight: 120kDa

Peptide Sequence: Synthetic peptide located within the following region: QALAEKVKEAERDVSLTSLAKLPSETIFVGCEFLHHLLREWGEELQAVLR

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Gem (Nuclear organelle) associated protein 4 EMBL AAH20062.1

Protein Size: 1058

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56757_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56757_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 50628
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×