Gfap Antibody - N-terminal region : FITC

Gfap Antibody - N-terminal region : FITC
Artikelnummer
AVIARP54621_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: GFAP, a class-III intermediate filament, is a cell-specific marker that, during the development of the central nervous system, distinguishes astrocytes from other glial cells.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse

Molecular Weight: 46kDa

Peptide Sequence: Synthetic peptide located within the following region: FSLAGALNAGFKETRASERAEMMELNDRFASYIEKVRFLEQQNKALAAEL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Glial fibrillary acidic protein

Protein Size: 418

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54621_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54621_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting, Immunohistochemistry
Human Gene ID 14580
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×