GGA3 Antibody - N-terminal region : Biotin

GGA3 Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP55423_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: This gene encodes a member of the Golgi-localized, gamma adaptin ear-containing, ARF-binding (GGA) family. This family includes ubiquitous coat proteins that regulate the trafficking of proteins between the trans-Golgi network and the lysosome. These prot

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human GGA3

Key Reference: Wang,J., (2007) Mol. Biol. Cell 18 (7), 2646-2655

Molecular Weight: 78kDa

Peptide Sequence: Synthetic peptide located within the following region: AKLLKSKNPDDLQEANKLIKSMVKEDEARIQKVTKRLHTLEEVNNNVRLL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: ADP-ribosylation factor-binding protein GGA3

Protein Size: 723

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55423_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55423_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 23163
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×