GGA3 Antibody - N-terminal region : HRP

GGA3 Antibody - N-terminal region : HRP
Artikelnummer
AVIARP55423_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: This gene encodes a member of the Golgi-localized, gamma adaptin ear-containing, ARF-binding (GGA) family. This family includes ubiquitous coat proteins that regulate the trafficking of proteins between the trans-Golgi network and the lysosome. These prot

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human GGA3

Key Reference: Wang,J., (2007) Mol. Biol. Cell 18 (7), 2646-2655

Molecular Weight: 78kDa

Peptide Sequence: Synthetic peptide located within the following region: AKLLKSKNPDDLQEANKLIKSMVKEDEARIQKVTKRLHTLEEVNNNVRLL

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: ADP-ribosylation factor-binding protein GGA3

Protein Size: 723

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55423_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55423_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 23163
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×