GIMAP2 Antibody - middle region : FITC

GIMAP2 Antibody - middle region : FITC
Artikelnummer
AVIARP56177_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene encodes a protein belonging to the GTP-binding superfamily and to the immuno-associated nucleotide (IAN) subfamily of nucleotide-binding proteins. In humans, the IAN subfamily genes are located in a cluster at 7q36.1.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human GIMAP2

Molecular Weight: 37kDa

Peptide Sequence: Synthetic peptide located within the following region: LVTQLGRYTSQDQQAAQRVKEIFGEDAMGHTIVLFTHKEDLNGGSLMDYM

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: GTPase IMAP family member 2

Protein Size: 337

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56177_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56177_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 26157
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×