GIMAP6 Antibody - C-terminal region : Biotin

GIMAP6 Antibody - C-terminal region : Biotin
Artikelnummer
AVIARP56178_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: This gene encodes a protein belonging to the GTP-binding superfamily and to the immuno-associated nucleotide (IAN) subfamily of nucleotide-binding proteins. In humans, IAN subfamily genes are located in a cluster at 7q36.1. Two transcript variants, one protein-coding and the other probably non-protein-coding, have been found for this gene.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human GIMAP6

Molecular Weight: 32kDa

Peptide Sequence: Synthetic peptide located within the following region: GVGVLGHTILVFTRKEDLAGGSLEDYVRETNNQALAWLDVTLARRHCGFN

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: GTPase IMAP family member 6

Protein Size: 292

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56178_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56178_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 474344
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×