GK2 Antibody - C-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: GK2 belongs to the FGGY kinase family. GK2 is a key enzyme in the regulation of glycerol uptake and metabolism.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human GK2

Key Reference: Sargent,C.A., (1994) Hum. Mol. Genet. 3 (8), 1317-1324

Molecular Weight: 61kDa

Peptide Sequence: Synthetic peptide located within the following region: QIQATESEIRYATWKKAVMKSMGWVTSQSPEGGDPSIFSSLPLGFFIVSS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Glycerol kinase 2

Protein Size: 553

Purification: Affinity Purified

• Artikelnummer: AVIARP53815_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP53815_P050-FITC
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rabbit, Guinea Pig, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 2712
• Wirt: Rabbit
• Konjugat: Conjugated, FITC