GK2 Antibody - N-terminal region : HRP

GK2 Antibody - N-terminal region : HRP
Artikelnummer
AVIARP53814_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: GK2 belongs to the FGGY kinase family. GK2 is a key enzyme in the regulation of glycerol uptake and metabolism.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human GK2

Molecular Weight: 61kDa

Peptide Sequence: Synthetic peptide located within the following region: DKLTGEPLYNAVVWLDLRTQTTVEDLSKKIPGNSNFVKSKTGLPLSTYFS

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Glycerol kinase 2

Protein Size: 553

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP53814_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP53814_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 2712
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×