GLDC Antibody - C-terminal region : Biotin

Conjugation: Biotin

Description of Target: Degradation of glycine is brought about by the glycine cleavage system, which is composed of four mitochondrial protein components: P protein (a pyridoxal phosphate-dependent glycine decarboxylase), H protein (a lipoic acid-containing protein), T protein (a tetrahydrofolate-requiring enzyme), and L protein (a lipoamide dehydrogenase). The protein encoded by this gene is the P protein, which binds to glycine and enables the methylamine group from glycine to be transferred to the T protein. Defects in this gene are a cause of nonketotic hyperglycinemia (NKH).

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human GCSP

Key Reference: N/A

Molecular Weight: 112kDa

Peptide Sequence: Synthetic peptide located within the following region: ANIEAVDVAKRLQDYGFHAPTMSWPVAGTLMVEPTESEDKAELDRFCDAM

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: glycine dehydrogenase (decarboxylating), mitochondrial

Protein Size: 1020

Purification: Affinity purified

• Artikelnummer: AVIARP54298_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP54298_P050-Biotin
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 2731
• Wirt: Rabbit
• Konjugat: Conjugated, Biotin