GLDC Antibody - C-terminal region : FITC

GLDC Antibody - C-terminal region : FITC
Artikelnummer
AVIARP54298_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Degradation of glycine is brought about by the glycine cleavage system, which is composed of four mitochondrial protein components: P protein (a pyridoxal phosphate-dependent glycine decarboxylase), H protein (a lipoic acid-containing protein), T protein (a tetrahydrofolate-requiring enzyme), and L protein (a lipoamide dehydrogenase). The protein encoded by this gene is the P protein, which binds to glycine and enables the methylamine group from glycine to be transferred to the T protein. Defects in this gene are a cause of nonketotic hyperglycinemia (NKH).

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human GCSP

Key Reference: N/A

Molecular Weight: 112kDa

Peptide Sequence: Synthetic peptide located within the following region: ANIEAVDVAKRLQDYGFHAPTMSWPVAGTLMVEPTESEDKAELDRFCDAM

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: glycine dehydrogenase (decarboxylating), mitochondrial

Protein Size: 1020

Purification: Affinity purified
Mehr Informationen
Artikelnummer AVIARP54298_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54298_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 2731
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×