GLO1 Antibody - N-terminal region : HRP

GLO1 Antibody - N-terminal region : HRP
Artikelnummer
AVIARP54803_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The enzyme encoded by this gene is responsible for the catalysis and formation of S-lactoyl-glutathione from methylglyoxal condensation and reduced glutatione. Glyoxalase I is linked to HLA and is localized to 6p21.3-p21.1, between HLA and the centromere.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human GLO1

Key Reference: Degaffe,G.H., (er) J. Diabetes Complicat. (2008) In press

Molecular Weight: 21kDa

Peptide Sequence: Synthetic peptide located within the following region: TMLRVKDPKKSLDFYTRVLGMTLIQKCDFPIMKFSLYFLAYEDKNDIPKE

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Lactoylglutathione lyase

Protein Size: 184

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54803_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54803_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 2739
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×