GLOD4 Antibody - middle region : Biotin

GLOD4 Antibody - middle region : Biotin
Artikelnummer
AVIARP56829_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human GLOD4

Key Reference: Zhang,H.T., (2003) Sheng Wu Hua Xue Yu Sheng Wu Wu Li Xue Bao 35 (8), 747-751

Molecular Weight: 33kDa

Peptide Sequence: Synthetic peptide located within the following region: LAVSDLQKSLNYWCNLLGMKIYEKDEEKQRALLGYADNQCKLELQGVKGG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Glyoxalase domain-containing protein 4

Protein Size: 298

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56829_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56829_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 51031
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×